PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_24532A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 451aa    MW: 48782.7 Da    PI: 6.7161
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_24532AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.91.8e-164289148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               +g+WT+ Ed  lvd v+++G g+W+++ r+ g+ R++k+c++rw ++l
  Oropetium_20150105_24532A 42 KGPWTAAEDAMLVDHVRRHGEGNWNAVQRMTGLLRCGKSCRLRWTNHL 89
                               79******************************99***********996 PP

2Myb_DNA-binding47.73.6e-1595138146
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                +g +T++E+  ++++++qlG++ W++ a++++ gRt++++k++w++
  Oropetium_20150105_24532A  95 KGCFTPDEEVVIAQLHAQLGNK-WARMAAHLP-GRTDNEIKNYWNT 138
                                789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.9093789IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.8E-213992IPR009057Homeodomain-like
SuperFamilySSF466896.74E-2940136IPR009057Homeodomain-like
SMARTSM007173.6E-144191IPR001005SANT/Myb domain
PfamPF002492.4E-144289IPR001005SANT/Myb domain
CDDcd001672.64E-114489No hitNo description
PROSITE patternPS0017505766IPR001345Phosphoglycerate/bisphosphoglycerate mutase, active site
PROSITE profilePS5129422.27690144IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-2393143IPR009057Homeodomain-like
SMARTSM007175.7E-1394142IPR001005SANT/Myb domain
PfamPF002491.0E-1395138IPR001005SANT/Myb domain
CDDcd001677.47E-1098138No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008152Biological Processmetabolic process
GO:0003677Molecular FunctionDNA binding
GO:0003824Molecular Functioncatalytic activity
Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    Send to blast
METNKNSGVA APKSPLDEEE KAAAAAAAAG QQQQHEVMAL KKGPWTAAED AMLVDHVRRH  60
GEGNWNAVQR MTGLLRCGKS CRLRWTNHLR PNLKKGCFTP DEEVVIAQLH AQLGNKWARM  120
AAHLPGRTDN EIKNYWNTRT KRRQRAGLPV YPPEVQLHLV LSKRCRFDEL SPLAPPPQLS  180
SESNTVQLTT MDTAAGGCGY TSARPAPLDL AAQQQQLAMT TTTKHQTVQF LSPPPPPFSA  240
PSSPWARCFA RNAHYFQFAR WSPVSPSTPP DLSLGYQGSR HPPPLSPSPV GPRAELPSNQ  300
FVGQASAAVV TAVGILGGGG SGVGRPVPVP DQPNAASLEK MLQELHEAIK IDQVPAGDEK  360
AVLEQHDHGT AVSEDKPEGE LNKDDIETLF DLMIPPFNAA EHAPPADPAP NHSRSVSQQS  420
SDDHDLPATS PDQEWSLDSA CQWSNVSRIC *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-274014325127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0425371e-140BT042537.1 Zea mays full-length cDNA clone ZM_BFb0325G13 mRNA, complete cds.
GenBankKJ7275321e-140KJ727532.1 Zea mays clone pUT5392 MYB transcription factor (MYB129) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982528.11e-160PREDICTED: myb-related protein P-like
TrEMBLM0XIM71e-142M0XIM7_HORVD; Uncharacterized protein
STRINGMLOC_6041.11e-141(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP74203750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.12e-66myb domain protein 101